PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00051027001
Common NameGSBRNA2T00051027001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 373aa    MW: 42063 Da    PI: 7.6093
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00051027001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like993.2e-31192246155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r+rWt++LH++F+e+v++LGG++kAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  GSBRNA2T00051027001 192 KTRIRWTQDLHDKFLECVNRLGGADKATPKAILKLMDSEGLTIFHVKSHLQKYRI 246
                          68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.326189249IPR017930Myb domain
SuperFamilySSF466893.58E-17189246IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-27191247IPR009057Homeodomain-like
TIGRFAMsTIGR015579.4E-24192247IPR006447Myb domain, plants
PfamPF002492.9E-8196245IPR001005SANT/Myb domain
PfamPF143794.0E-20276323IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MDNNFESSNA SQGSRLQLHP QPPQPFNLQD VDTIHYSQTS PWTTETFSGF TPYDCIANQS  60
FSLQCSSSKP YPPSLHSYDH QSSDPPSLDQ SQSMVPMQPS PDQYLKPLYK RSCVNDFAAT  120
NASSASYSLC FGASQDPQEI CRGNYSNSNV TQLSFSLSHH QPKQTHSRFS SPSFSTYGGS  180
MVRNYGTVTG NKTRIRWTQD LHDKFLECVN RLGGADKATP KAILKLMDSE GLTIFHVKSH  240
LQKYRIAKYI PDPREGKFEK RSCSKELSQL DTKTGVQIKE ALQLQLDVQR HLHEQLEIQR  300
NLQVRIEEQG KQLKLMIEQQ QKTKESLLKS PNAEVSLPLS AFDRSPPPFS LQDAEAMMLP  360
SYEDTHFQSK IS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009130962.10.0PREDICTED: probable transcription factor KAN3
TrEMBLA0A078JHF30.0A0A078JHF3_BRANA; BnaA03g55680D protein
STRINGBra005912.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54762748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.10.0G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]